DNMT1 polyclonal antibody
  • DNMT1 polyclonal antibody

DNMT1 polyclonal antibody

Ref: AB-PAB28593
DNMT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNMT1.
Información adicional
Size 100 uL
Gene Name DNMT1
Gene Alias AIM|CXXC9|DNMT|FLJ16293|MCMT|MGC104992
Gene Description DNA (cytosine-5-)-methyltransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNMT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1786
Iso type IgG

Enviar un mensaje


DNMT1 polyclonal antibody

DNMT1 polyclonal antibody