CDK6 polyclonal antibody
  • CDK6 polyclonal antibody

CDK6 polyclonal antibody

Ref: AB-PAB28592
CDK6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDK6.
Información adicional
Size 100 uL
Gene Name CDK6
Gene Alias MGC59692|PLSTIRE|STQTL11
Gene Description cyclin-dependent kinase 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDK6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1021
Iso type IgG

Enviar un mensaje


CDK6 polyclonal antibody

CDK6 polyclonal antibody