APOA4 polyclonal antibody
  • APOA4 polyclonal antibody

APOA4 polyclonal antibody

Ref: AB-PAB28585
APOA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APOA4.
Información adicional
Size 100 uL
Gene Name APOA4
Gene Alias MGC142154|MGC142156
Gene Description apolipoprotein A-IV
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APOA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 337
Iso type IgG

Enviar un mensaje


APOA4 polyclonal antibody

APOA4 polyclonal antibody