COX4I1 polyclonal antibody
  • COX4I1 polyclonal antibody

COX4I1 polyclonal antibody

Ref: AB-PAB28582
COX4I1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COX4I1.
Información adicional
Size 100 uL
Gene Name COX4I1
Gene Alias COX4|COXIV|MGC72016
Gene Description cytochrome c oxidase subunit IV isoform 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COX4I1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1327
Iso type IgG

Enviar un mensaje


COX4I1 polyclonal antibody

COX4I1 polyclonal antibody