HYAL1 polyclonal antibody
  • HYAL1 polyclonal antibody

HYAL1 polyclonal antibody

Ref: AB-PAB28571
HYAL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HYAL1.
Información adicional
Size 100 uL
Gene Name HYAL1
Gene Alias HYAL-1|LUCA1|MGC45987|NAT6
Gene Description hyaluronoglucosaminidase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HYAL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3373
Iso type IgG

Enviar un mensaje


HYAL1 polyclonal antibody

HYAL1 polyclonal antibody