SULT1B1 polyclonal antibody
  • SULT1B1 polyclonal antibody

SULT1B1 polyclonal antibody

Ref: AB-PAB28569
SULT1B1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SULT1B1.
Información adicional
Size 100 uL
Gene Name SULT1B1
Gene Alias MGC13356|ST1B2|SULT1B2
Gene Description sulfotransferase family, cytosolic, 1B, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SULT1B1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27284
Iso type IgG

Enviar un mensaje


SULT1B1 polyclonal antibody

SULT1B1 polyclonal antibody