ORAI1 polyclonal antibody
  • ORAI1 polyclonal antibody

ORAI1 polyclonal antibody

Ref: AB-PAB28561
ORAI1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ORAI1.
Información adicional
Size 100 uL
Gene Name ORAI1
Gene Alias CRACM1|FLJ14466|ORAT1|TMEM142A
Gene Description ORAI calcium release-activated calcium modulator 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Immunofluorescence(0.25-2 ug/mL)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ORAI1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84876
Iso type IgG

Enviar un mensaje


ORAI1 polyclonal antibody

ORAI1 polyclonal antibody