TRPC1 polyclonal antibody
  • TRPC1 polyclonal antibody

TRPC1 polyclonal antibody

Ref: AB-PAB28558
TRPC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRPC1.
Información adicional
Size 100 uL
Gene Name TRPC1
Gene Alias HTRP-1|MGC133334|MGC133335|TRP1
Gene Description transient receptor potential cation channel, subfamily C, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYA
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TRPC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7220
Iso type IgG

Enviar un mensaje


TRPC1 polyclonal antibody

TRPC1 polyclonal antibody