KIAA0020 polyclonal antibody
  • KIAA0020 polyclonal antibody

KIAA0020 polyclonal antibody

Ref: AB-PAB28555
KIAA0020 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0020.
Información adicional
Size 100 uL
Gene Name KIAA0020
Gene Alias HLA-HA8|MGC8749|PEN|PUF6|XTP5
Gene Description KIAA0020
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLEKTKSTSKGI
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant KIAA0020.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9933
Iso type IgG

Enviar un mensaje


KIAA0020 polyclonal antibody

KIAA0020 polyclonal antibody