C1QA polyclonal antibody
  • C1QA polyclonal antibody

C1QA polyclonal antibody

Ref: AB-PAB28554
C1QA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1QA.
Información adicional
Size 100 uL
Gene Name C1QA
Gene Alias -
Gene Description complement component 1, q subcomponent, A chain
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS
Form Liquid
Recomended Dilution Immunohistochemistry(-)
Western Blot(-)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C1QA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 712
Iso type IgG

Enviar un mensaje


C1QA polyclonal antibody

C1QA polyclonal antibody