NCF2 polyclonal antibody
  • NCF2 polyclonal antibody

NCF2 polyclonal antibody

Ref: AB-PAB28551
NCF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NCF2.
Información adicional
Size 100 uL
Gene Name NCF2
Gene Alias FLJ93058|NCF-2|NOXA2|P67-PHOX|P67PHOX
Gene Description neutrophil cytosolic factor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQ
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant NCF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4688
Iso type IgG

Enviar un mensaje


NCF2 polyclonal antibody

NCF2 polyclonal antibody