GOLIM4 polyclonal antibody
  • GOLIM4 polyclonal antibody

GOLIM4 polyclonal antibody

Ref: AB-PAB28549
GOLIM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GOLIM4.
Información adicional
Size 100 uL
Gene Name GOLIM4
Gene Alias GIMPC|GOLPH4|GPP130|P138
Gene Description golgi integral membrane protein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant GOLIM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27333
Iso type IgG

Enviar un mensaje


GOLIM4 polyclonal antibody

GOLIM4 polyclonal antibody