PLSCR4 polyclonal antibody
  • PLSCR4 polyclonal antibody

PLSCR4 polyclonal antibody

Ref: AB-PAB28547
PLSCR4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLSCR4.
Información adicional
Size 100 uL
Gene Name PLSCR4
Gene Alias TRA1
Gene Description phospholipid scramblase 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq PQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSA
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PLSCR4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57088
Iso type IgG

Enviar un mensaje


PLSCR4 polyclonal antibody

PLSCR4 polyclonal antibody