IRF4 polyclonal antibody
  • IRF4 polyclonal antibody

IRF4 polyclonal antibody

Ref: AB-PAB28541
IRF4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IRF4.
Información adicional
Size 100 uL
Gene Name IRF4
Gene Alias LSIRF|MUM1
Gene Description interferon regulatory factor 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPE
Form Liquid
Recomended Dilution Western Blot (1:- 1:)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:-1:)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IRF4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3662
Iso type IgG

Enviar un mensaje


IRF4 polyclonal antibody

IRF4 polyclonal antibody