IDH3G polyclonal antibody
  • IDH3G polyclonal antibody

IDH3G polyclonal antibody

Ref: AB-PAB28538
IDH3G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IDH3G.
Información adicional
Size 100 uL
Gene Name IDH3G
Gene Alias H-IDHG
Gene Description isocitrate dehydrogenase 3 (NAD+) gamma
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
Form Liquid
Recomended Dilution Western Blot (1:100-1:500)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IDH3G.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3421
Iso type IgG

Enviar un mensaje


IDH3G polyclonal antibody

IDH3G polyclonal antibody