TFAP4 polyclonal antibody
  • TFAP4 polyclonal antibody

TFAP4 polyclonal antibody

Ref: AB-PAB28535
TFAP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TFAP4.
Información adicional
Size 100 uL
Gene Name TFAP4
Gene Alias AP-4|bHLHc41
Gene Description transcription factor AP-4 (activating enhancer binding protein 4)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TFAP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7023
Iso type IgG

Enviar un mensaje


TFAP4 polyclonal antibody

TFAP4 polyclonal antibody