GPKOW polyclonal antibody
  • GPKOW polyclonal antibody

GPKOW polyclonal antibody

Ref: AB-PAB28533
GPKOW polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPKOW.
Información adicional
Size 100 uL
Gene Name GPKOW
Gene Alias GPATC5|GPATCH5|T54
Gene Description G patch domain and KOW motifs
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPD
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPKOW.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27238
Iso type IgG

Enviar un mensaje


GPKOW polyclonal antibody

GPKOW polyclonal antibody