LRG1 polyclonal antibody
  • LRG1 polyclonal antibody

LRG1 polyclonal antibody

Ref: AB-PAB28531
LRG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRG1.
Información adicional
Size 100 uL
Gene Name LRG1
Gene Alias HMFT1766|LRG
Gene Description leucine-rich alpha-2-glycoprotein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116844
Iso type IgG

Enviar un mensaje


LRG1 polyclonal antibody

LRG1 polyclonal antibody