STAT6 polyclonal antibody
  • STAT6 polyclonal antibody

STAT6 polyclonal antibody

Ref: AB-PAB28498
STAT6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STAT6.
Información adicional
Size 100 uL
Gene Name STAT6
Gene Alias D12S1644|IL-4-STAT|STAT6B|STAT6C
Gene Description signal transducer and activator of transcription 6, interleukin-4 induced
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STAT6
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6778
Iso type IgG

Enviar un mensaje


STAT6 polyclonal antibody

STAT6 polyclonal antibody