STAT4 polyclonal antibody
  • STAT4 polyclonal antibody

STAT4 polyclonal antibody

Ref: AB-PAB28497
STAT4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STAT4.
Información adicional
Size 100 uL
Gene Name STAT4
Gene Alias SLEB11
Gene Description signal transducer and activator of transcription 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq PMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDL
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STAT4
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6775
Iso type IgG

Enviar un mensaje


STAT4 polyclonal antibody

STAT4 polyclonal antibody