SP1 polyclonal antibody
  • SP1 polyclonal antibody

SP1 polyclonal antibody

Ref: AB-PAB28496
SP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SP1.
Información adicional
Size 100 uL
Gene Name SP1
Gene Alias -
Gene Description Sp1 transcription factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq QVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCP
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:250-1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SP1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6667
Iso type IgG

Enviar un mensaje


SP1 polyclonal antibody

SP1 polyclonal antibody