TRAF1 polyclonal antibody
  • TRAF1 polyclonal antibody

TRAF1 polyclonal antibody

Ref: AB-PAB28495
TRAF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRAF1.
Información adicional
Size 100 uL
Gene Name TRAF1
Gene Alias EBI6|MGC:10353
Gene Description TNF receptor-associated factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSI
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRAF1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7185
Iso type IgG

Enviar un mensaje


TRAF1 polyclonal antibody

TRAF1 polyclonal antibody