TMOD3 polyclonal antibody
  • TMOD3 polyclonal antibody

TMOD3 polyclonal antibody

Ref: AB-PAB28494
TMOD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMOD3.
Información adicional
Size 100 uL
Gene Name TMOD3
Gene Alias UTMOD
Gene Description tropomodulin 3 (ubiquitous)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMOD3
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29766
Iso type IgG

Enviar un mensaje


TMOD3 polyclonal antibody

TMOD3 polyclonal antibody