SHC1 polyclonal antibody
  • SHC1 polyclonal antibody

SHC1 polyclonal antibody

Ref: AB-PAB28492
SHC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SHC1.
Información adicional
Size 100 uL
Gene Name SHC1
Gene Alias FLJ26504|SHC|SHCA
Gene Description SHC (Src homology 2 domain containing) transforming protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMG
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SHC1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6464
Iso type IgG

Enviar un mensaje


SHC1 polyclonal antibody

SHC1 polyclonal antibody