CREM polyclonal antibody
  • CREM polyclonal antibody

CREM polyclonal antibody

Ref: AB-PAB28489
CREM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CREM.
Información adicional
Size 100 uL
Gene Name CREM
Gene Alias ICER|MGC111110|MGC17881|MGC41893|hCREM-2
Gene Description cAMP responsive element modulator
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD
Form Liquid
Recomended Dilution Immunohistochemistry(1:500-1:1000)
Western Blot(1:250-1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CREM
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1390
Iso type IgG

Enviar un mensaje


CREM polyclonal antibody

CREM polyclonal antibody