TJP2 polyclonal antibody
  • TJP2 polyclonal antibody

TJP2 polyclonal antibody

Ref: AB-PAB28487
TJP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TJP2.
Información adicional
Size 100 uL
Gene Name TJP2
Gene Alias MGC26306|X104|ZO-2|ZO2
Gene Description tight junction protein 2 (zona occludens 2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TJP2
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9414
Iso type IgG

Enviar un mensaje


TJP2 polyclonal antibody

TJP2 polyclonal antibody