F13A1 polyclonal antibody
  • F13A1 polyclonal antibody

F13A1 polyclonal antibody

Ref: AB-PAB28486
F13A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant F13A1.
Información adicional
Size 100 uL
Gene Name F13A1
Gene Alias F13A
Gene Description coagulation factor XIII, A1 polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human F13A1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2162
Iso type IgG

Enviar un mensaje


F13A1 polyclonal antibody

F13A1 polyclonal antibody