SEMA3G polyclonal antibody
  • SEMA3G polyclonal antibody

SEMA3G polyclonal antibody

Ref: AB-PAB28485
SEMA3G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEMA3G.
Información adicional
Size 100 uL
Gene Name SEMA3G
Gene Alias FLJ00014|MGC119473|sem2
Gene Description sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3G
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIG
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEMA3G
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56920
Iso type IgG

Enviar un mensaje


SEMA3G polyclonal antibody

SEMA3G polyclonal antibody