ARNT polyclonal antibody
  • ARNT polyclonal antibody

ARNT polyclonal antibody

Ref: AB-PAB28484
ARNT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARNT.
Información adicional
Size 100 uL
Gene Name ARNT
Gene Alias HIF-1beta|HIF1B|HIF1BETA|TANGO|bHLHe2
Gene Description aryl hydrocarbon receptor nuclear translocator
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RFSCLRPRVAGTTEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMV
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARNT
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 405
Iso type IgG

Enviar un mensaje


ARNT polyclonal antibody

ARNT polyclonal antibody