SOX9 polyclonal antibody
  • SOX9 polyclonal antibody

SOX9 polyclonal antibody

Ref: AB-PAB28483
SOX9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SOX9.
Información adicional
Size 100 uL
Gene Name SOX9
Gene Alias CMD1|CMPD1|SRA1
Gene Description SRY (sex determining region Y)-box 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P
Immunogen Prot. Seq SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:100-1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SOX9
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6662
Iso type IgG

Enviar un mensaje


SOX9 polyclonal antibody

SOX9 polyclonal antibody