ZNF75A polyclonal antibody
  • ZNF75A polyclonal antibody

ZNF75A polyclonal antibody

Ref: AB-PAB28476
ZNF75A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF75A.
Información adicional
Size 100 uL
Gene Name ZNF75A
Gene Alias FLJ31529
Gene Description zinc finger protein 75a
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq QEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLM
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF75A
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7627
Iso type IgG

Enviar un mensaje


ZNF75A polyclonal antibody

ZNF75A polyclonal antibody