APOH polyclonal antibody
  • APOH polyclonal antibody

APOH polyclonal antibody

Ref: AB-PAB28473
APOH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APOH.
Información adicional
Size 100 uL
Gene Name APOH
Gene Alias B2G1|BG
Gene Description apolipoprotein H (beta-2-glycoprotein I)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APOH
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 350
Iso type IgG

Enviar un mensaje


APOH polyclonal antibody

APOH polyclonal antibody