KNG1 polyclonal antibody
  • KNG1 polyclonal antibody

KNG1 polyclonal antibody

Ref: AB-PAB28471
KNG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KNG1.
Información adicional
Size 100 uL
Gene Name KNG1
Gene Alias BDK|KNG
Gene Description kininogen 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETK
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KNG1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3827
Iso type IgG

Enviar un mensaje


KNG1 polyclonal antibody

KNG1 polyclonal antibody