RBM22 polyclonal antibody
  • RBM22 polyclonal antibody

RBM22 polyclonal antibody

Ref: AB-PAB28467
RBM22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM22.
Información adicional
Size 100 uL
Gene Name RBM22
Gene Alias FLJ10290|ZC3H16|fSAP47
Gene Description RNA binding motif protein 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM22
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55696
Iso type IgG

Enviar un mensaje


RBM22 polyclonal antibody

RBM22 polyclonal antibody