MAP2K7 polyclonal antibody
  • MAP2K7 polyclonal antibody

MAP2K7 polyclonal antibody

Ref: AB-PAB28466
MAP2K7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAP2K7.
Información adicional
Size 100 uL
Gene Name MAP2K7
Gene Alias Jnkk2|MAPKK7|MKK7|PRKMK7
Gene Description mitogen-activated protein kinase kinase 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETMEV
Form Liquid
Recomended Dilution Immunohistochemistry(1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAP2K7
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5609
Iso type IgG

Enviar un mensaje


MAP2K7 polyclonal antibody

MAP2K7 polyclonal antibody