PON1 polyclonal antibody
  • PON1 polyclonal antibody

PON1 polyclonal antibody

Ref: AB-PAB28460
PON1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PON1.
Información adicional
Size 100 uL
Gene Name PON1
Gene Alias ESA|PON
Gene Description paraoxonase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PON1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5444
Iso type IgG

Enviar un mensaje


PON1 polyclonal antibody

PON1 polyclonal antibody