KIAA1333 polyclonal antibody
  • KIAA1333 polyclonal antibody

KIAA1333 polyclonal antibody

Ref: AB-PAB28458
KIAA1333 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1333.
Información adicional
Size 100 uL
Gene Name KIAA1333
Gene Alias FLJ20333|G2E3|PHF7B
Gene Description KIAA1333
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant KIAA1333.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55632
Iso type IgG

Enviar un mensaje


KIAA1333 polyclonal antibody

KIAA1333 polyclonal antibody