ELK3 polyclonal antibody
  • ELK3 polyclonal antibody

ELK3 polyclonal antibody

Ref: AB-PAB28457
ELK3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ELK3.
Información adicional
Size 100 uL
Gene Name ELK3
Gene Alias ERP|NET|SAP2
Gene Description ELK3, ETS-domain protein (SRF accessory protein 2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR
Form Liquid
Recomended Dilution Immunohistochemistry(1:500-1:1000)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ELK3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2004
Iso type IgG

Enviar un mensaje


ELK3 polyclonal antibody

ELK3 polyclonal antibody