CYB5R3 polyclonal antibody
  • CYB5R3 polyclonal antibody

CYB5R3 polyclonal antibody

Ref: AB-PAB28452
CYB5R3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CYB5R3.
Información adicional
Size 100 uL
Gene Name CYB5R3
Gene Alias B5R|DIA1
Gene Description cytochrome b5 reductase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH
Form Liquid
Recomended Dilution Immunohistochemistry(1:1000-1:2500)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CYB5R3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1727
Iso type IgG

Enviar un mensaje


CYB5R3 polyclonal antibody

CYB5R3 polyclonal antibody