SERPINI1 polyclonal antibody
  • SERPINI1 polyclonal antibody

SERPINI1 polyclonal antibody

Ref: AB-PAB28451
SERPINI1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SERPINI1.
Información adicional
Size 100 uL
Gene Name SERPINI1
Gene Alias DKFZp781N13156|PI12|neuroserpin
Gene Description serpin peptidase inhibitor, clade I (neuroserpin), member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGI
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant SERPINI1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5274
Iso type IgG

Enviar un mensaje


SERPINI1 polyclonal antibody

SERPINI1 polyclonal antibody