ATF3 polyclonal antibody
  • ATF3 polyclonal antibody

ATF3 polyclonal antibody

Ref: AB-PAB28450
ATF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATF3.
Información adicional
Size 100 uL
Gene Name ATF3
Gene Alias -
Gene Description activating transcription factor 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ATF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 467
Iso type IgG

Enviar un mensaje


ATF3 polyclonal antibody

ATF3 polyclonal antibody