BCHE polyclonal antibody
  • BCHE polyclonal antibody

BCHE polyclonal antibody

Ref: AB-PAB28449
BCHE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCHE.
Información adicional
Size 100 uL
Gene Name BCHE
Gene Alias CHE1|E1
Gene Description butyrylcholinesterase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant BCHE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 590
Iso type IgG

Enviar un mensaje


BCHE polyclonal antibody

BCHE polyclonal antibody