ATP5B polyclonal antibody
  • ATP5B polyclonal antibody

ATP5B polyclonal antibody

Ref: AB-PAB28448
ATP5B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATP5B.
Información adicional
Size 100 uL
Gene Name ATP5B
Gene Alias ATPMB|ATPSB|MGC5231
Gene Description ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
Form Liquid
Recomended Dilution Immunohistochemistry(1:500-1:1000)
Western Blot(1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ATP5B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 506
Iso type IgG

Enviar un mensaje


ATP5B polyclonal antibody

ATP5B polyclonal antibody