LBP polyclonal antibody
  • LBP polyclonal antibody

LBP polyclonal antibody

Ref: AB-PAB28447
LBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LBP.
Información adicional
Size 100 uL
Gene Name LBP
Gene Alias MGC22233
Gene Description lipopolysaccharide binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYI
Form Liquid
Recomended Dilution Immunohistochemistry(1:150)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant LBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3929
Iso type IgG

Enviar un mensaje


LBP polyclonal antibody

LBP polyclonal antibody