C1QC polyclonal antibody
  • C1QC polyclonal antibody

C1QC polyclonal antibody

Ref: AB-PAB28439
C1QC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1QC.
Información adicional
Size 100 uL
Gene Name C1QC
Gene Alias C1Q-C|C1QG|FLJ27103
Gene Description complement component 1, q subcomponent, C chain
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C1QC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 714
Iso type IgG

Enviar un mensaje


C1QC polyclonal antibody

C1QC polyclonal antibody