CNTN2 polyclonal antibody
  • CNTN2 polyclonal antibody

CNTN2 polyclonal antibody

Ref: AB-PAB28428
CNTN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNTN2.
Información adicional
Size 100 uL
Gene Name CNTN2
Gene Alias AXT|DKFZp781D102|FLJ42746|MGC157722|TAG-1|TAX|TAX1
Gene Description contactin 2 (axonal)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CNTN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6900
Iso type IgG

Enviar un mensaje


CNTN2 polyclonal antibody

CNTN2 polyclonal antibody