FLOT2 polyclonal antibody
  • FLOT2 polyclonal antibody

FLOT2 polyclonal antibody

Ref: AB-PAB28427
FLOT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLOT2.
Información adicional
Size 100 uL
Gene Name FLOT2
Gene Alias ECS-1|ECS1|ESA|ESA1|M17S1
Gene Description flotillin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
Form Liquid
Recomended Dilution Immunohistochemistry(1:2500-1:5000)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant FLOT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2319
Iso type IgG

Enviar un mensaje


FLOT2 polyclonal antibody

FLOT2 polyclonal antibody