TXNDC4 polyclonal antibody
  • TXNDC4 polyclonal antibody

TXNDC4 polyclonal antibody

Ref: AB-PAB28413
TXNDC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNDC4.
Información adicional
Size 100 uL
Gene Name TXNDC4
Gene Alias ERP44|KIAA0573
Gene Description thioredoxin domain containing 4 (endoplasmic reticulum)
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPD
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TXNDC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23071
Iso type IgG

Enviar un mensaje


TXNDC4 polyclonal antibody

TXNDC4 polyclonal antibody