TAP2 polyclonal antibody
  • TAP2 polyclonal antibody

TAP2 polyclonal antibody

Ref: AB-PAB28412
TAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TAP2.
Información adicional
Size 100 uL
Gene Name TAP2
Gene Alias ABC18|ABCB3|APT2|D6S217E|PSF2|RING11
Gene Description transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQA
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6891
Iso type IgG

Enviar un mensaje


TAP2 polyclonal antibody

TAP2 polyclonal antibody