SUB1 polyclonal antibody
  • SUB1 polyclonal antibody

SUB1 polyclonal antibody

Ref: AB-PAB28411
SUB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SUB1.
Información adicional
Size 100 uL
Gene Name SUB1
Gene Alias MGC102747|P15|PC4|p14
Gene Description SUB1 homolog (S. cerevisiae)
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SUB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10923
Iso type IgG

Enviar un mensaje


SUB1 polyclonal antibody

SUB1 polyclonal antibody